Recombinant Human H2BC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | H2BC1-5162H |
Product Overview : | HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | H2BC1 H2B clustered histone 1 [ Homo sapiens (human) ] |
Official Symbol | H2BC1 |
Synonyms | HIST1H2BA; histone cluster 1, H2ba; H2B histone family, member U, (testis specific), histone 1, H2ba; histone H2B type 1-A; bA317E16.3; H2BFU; STBP; TSH2B; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; H2B histone family, member U, (testis-specific); |
Gene ID | 255626 |
mRNA Refseq | NM_170610 |
Protein Refseq | NP_733759 |
MIM | 609904 |
UniProt ID | Q96A08 |
◆ Recombinant Proteins | ||
H2BC1-5162H | Recombinant Human H2BC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2BC1 Products
Required fields are marked with *
My Review for All H2BC1 Products
Required fields are marked with *
0
Inquiry Basket