Recombinant Human H2BC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: H2BC1-5162H
• Product Overview: HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.
• Molecular Mass: 14.2 kDa
• AA Sequence: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: H2BC1 H2B clustered histone 1 [ Homo sapiens (human) ]
• Official Symbol: H2BC1
• Synonyms: HIST1H2BA; histone cluster 1, H2ba; H2B histone family, member U, (testis specific), histone 1, H2ba; histone H2B type 1-A; bA317E16.3; H2BFU; STBP; TSH2B; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; H2B histone family, member U, (testis-specific)
• Gene ID: 255626
• mRNA Refseq: NM_170610
• Protein Refseq: NP_733759
• MIM: 609904
• UniProt ID: Q96A08