Recombinant Human H2BC4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : H2BC4-4244H
Product Overview : HIST1H2BC MS Standard C13 and N15-labeled recombinant protein (NP_003517) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. The protein has antibacterial and antifungal antimicrobial activity. The main transcript variant of this gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. This transcript variant lacks a polyA tail but instead contains a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
Molecular Mass : 13.7 kDa
AA Sequence : MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name H2BC4 H2B clustered histone 4 [ Homo sapiens (human) ]
Official Symbol H2BC4
Synonyms H2BC4; H2B clustered histone 4; H2B.1; H2B/l; H2BC6; H2BC7; H2BC8; H2BFL; H2BC10; HIST1H2BC; dJ221C16.3; histone H2B type 1-C/E/F/G/I; H2B histone family, member L; histone 1, H2bc; histone H2B.1 A; histone H2B.l; histone cluster 1 H2B family member c; histone cluster 1, H2bc
Gene ID 8347
mRNA Refseq NM_003526
Protein Refseq NP_003517
MIM 602847
UniProt ID P62807

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2BC4 Products

Required fields are marked with *

My Review for All H2BC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon