Recombinant Human H2BFWT Protein, GST-tagged

Cat.No. : H2BFWT-4541H
Product Overview : Human H2BFWT partial ORF ( NP_001002916.1, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the H2B histone family that is specifically expressed in sperm nuclei. A polymorphism in the 5' UTR of this gene is associated with male infertility.[provided by RefSeq, Oct 2015]
Molecular Mass : 36.74 kDa
AA Sequence : GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H2BFWT H2B histone family member W, testis specific [ Homo sapiens (human) ]
Official Symbol H2BFWT
Synonyms H2BFWT; H2B histone family member W, testis specific; histone H2B type W-T; H2B Histone Family Member W, Testis Specific; H2B Histone Family, Member W, Testis-Specific; H2B Histone Family Member W Testis-Specific; H2A Histone Family Member B2; H2A.Bbd; H2A Histone Family, Member B2; Histone H2A-Bbd Type 2/3; H2A Barr Body-Deficient; H2A Barr Body Deficient; H2AFB2 H2AFB3
Gene ID 158983
mRNA Refseq NM_001002916
Protein Refseq NP_001002916
MIM 300507
UniProt ID Q7Z2G1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2BFWT Products

Required fields are marked with *

My Review for All H2BFWT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon