Recombinant Human H2BFWT Protein, GST-tagged
Cat.No. : | H2BFWT-4541H |
Product Overview : | Human H2BFWT partial ORF ( NP_001002916.1, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the H2B histone family that is specifically expressed in sperm nuclei. A polymorphism in the 5' UTR of this gene is associated with male infertility.[provided by RefSeq, Oct 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2BFWT H2B histone family member W, testis specific [ Homo sapiens (human) ] |
Official Symbol | H2BFWT |
Synonyms | H2BFWT; H2B histone family member W, testis specific; histone H2B type W-T; H2B Histone Family Member W, Testis Specific; H2B Histone Family, Member W, Testis-Specific; H2B Histone Family Member W Testis-Specific; H2A Histone Family Member B2; H2A.Bbd; H2A Histone Family, Member B2; Histone H2A-Bbd Type 2/3; H2A Barr Body-Deficient; H2A Barr Body Deficient; H2AFB2 H2AFB3 |
Gene ID | 158983 |
mRNA Refseq | NM_001002916 |
Protein Refseq | NP_001002916 |
MIM | 300507 |
UniProt ID | Q7Z2G1 |
◆ Recombinant Proteins | ||
H2BFWT-2031R | Recombinant Rhesus monkey H2BFWT Protein, His-tagged | +Inquiry |
H2BFWT-4541H | Recombinant Human H2BFWT Protein, GST-tagged | +Inquiry |
H2BFWT-1852R | Recombinant Rhesus Macaque H2BFWT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2BFWT-315HCL | Recombinant Human H2BFWT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2BFWT Products
Required fields are marked with *
My Review for All H2BFWT Products
Required fields are marked with *