Recombinant Human H2BU1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : H2BU1-4322H
Product Overview : HIST3H2BB MS Standard C13 and N15-labeled recombinant protein (NP_778225) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.
Molecular Mass : 13.9 kDa
AA Sequence : MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name H2BU1 H2B.U histone 1 [ Homo sapiens (human) ]
Official Symbol H2BU1
Synonyms H2BU1; H2B.U histone 1; H2Bb; HIST3H2BB; histone H2B type 3-B; H2B type 12; histone 3, H2bb; histone cluster 3 H2B family member b; histone cluster 3, H2bb
Gene ID 128312
mRNA Refseq NM_175055
Protein Refseq NP_778225
MIM 615046
UniProt ID Q8N257

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2BU1 Products

Required fields are marked with *

My Review for All H2BU1 Products

Required fields are marked with *

0
cart-icon
0
compare icon