Recombinant Human H3F3B Protein, GST-tagged

Cat.No. : H3F3B-1729H
Product Overview : Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with GST tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 3-136 a.a.
Form : Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
AA Sequence : RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Purity : 85 %
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage
Gene Name H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ]
Official Symbol H3F3B
Synonyms H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A;
Gene ID 3021
mRNA Refseq NM_005324
Protein Refseq NP_005315
MIM 601058
UniProt ID P84243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H3F3B Products

Required fields are marked with *

My Review for All H3F3B Products

Required fields are marked with *

0
cart-icon