Recombinant Human H3F3B Protein, His-tagged
| Cat.No. : | H3F3B-1728H |
| Product Overview : | Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-136 a.a. |
| Form : | Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
| AA Sequence : | RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Purity : | 90 % |
| Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
| Gene Name | H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ] |
| Official Symbol | H3F3B |
| Synonyms | H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A; |
| Gene ID | 3021 |
| mRNA Refseq | NM_005324 |
| Protein Refseq | NP_005315 |
| MIM | 601058 |
| UniProt ID | P84243 |
| ◆ Recombinant Proteins | ||
| H3F3B-3411HF | Recombinant Full Length Human H3F3B Protein, GST-tagged | +Inquiry |
| H3F3B-6848C | Recombinant Chicken H3F3B | +Inquiry |
| H3F3B-1728H | Recombinant Human H3F3B Protein, His-tagged | +Inquiry |
| H3F3B-1729H | Recombinant Human H3F3B Protein, GST-tagged | +Inquiry |
| H3F3B-4543H | Recombinant Human H3F3B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H3F3B-5653HCL | Recombinant Human H3F3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H3F3B Products
Required fields are marked with *
My Review for All H3F3B Products
Required fields are marked with *
