Recombinant Human H4-16 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | H4-16-5839H |
Product Overview : | HIST4H4 MS Standard C13 and N15-labeled recombinant protein (NP_778224) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | H4-16 H4 histone 16 [ Homo sapiens (human) ] |
Official Symbol | H4-16 |
Synonyms | H4-16; H4 histone 16; H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; histone H4; histone 4, H4; histone cluster 4 H4 |
Gene ID | 121504 |
mRNA Refseq | NM_175054 |
Protein Refseq | NP_778224 |
MIM | 615069 |
UniProt ID | P62805 |
◆ Recombinant Proteins | ||
H4-16-5839H | Recombinant Human H4-16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H4-16 Products
Required fields are marked with *
My Review for All H4-16 Products
Required fields are marked with *
0
Inquiry Basket