Recombinant Human HACL1, His-tagged

Cat.No. : HACL1-26022TH
Product Overview : Recombinant fragment, corresponding to amino acids 393-578 of Human 2 Hydroxy phytanoyl CoA lyase with N terminal His tag; MWt 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 393-578 a.a.
Description : By analyzing 1,780,295 5-end sequences of human full-length cDNAs derived from 164 kinds of oligo-cap cDNA libraries, we identified 269,774 independent positions of transcriptional start sites (TSSs) for 14,628 human RefSeq genes.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGF AIAAAVVAKDRSPGQWIICVEGDSAFGFSGMEVETICR YNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVP PMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSL ADTTKPSLINIMIEPQATRKAQDFHWLTRSNM
Gene Name HACL1 2-hydroxyacyl-CoA lyase 1 [ Homo sapiens ]
Official Symbol HACL1
Synonyms HACL1; 2-hydroxyacyl-CoA lyase 1; 2 hydroxyphytanoyl CoA lyase , HPCL; 2 HPCL; PHYH2;
Gene ID 26061
mRNA Refseq NM_012260
Protein Refseq NP_036392
MIM 604300
Uniprot ID Q9UJ83
Chromosome Location 3p24.3
Pathway Alpha-oxidation of phytanate, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Peroxisomal lipid metabolism, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem;
Function carbon-carbon lyase activity; carbon-carbon lyase activity; identical protein binding; magnesium ion binding; thiamine pyrophosphate binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HACL1 Products

Required fields are marked with *

My Review for All HACL1 Products

Required fields are marked with *

0
cart-icon