Recombinant Human HACL1, His-tagged

• Cat.No.: HACL1-26022TH
• Product Overview: Recombinant fragment, corresponding to amino acids 393-578 of Human 2 Hydroxy phytanoyl CoA lyase with N terminal His tag; MWt 22kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 393-578 a.a.
• Description: By analyzing 1,780,295 5-end sequences of human full-length cDNAs derived from 164 kinds of oligo-cap cDNA libraries, we identified 269,774 independent positions of transcriptional start sites (TSSs) for 14,628 human RefSeq genes.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 86 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGF AIAAAVVAKDRSPGQWIICVEGDSAFGFSGMEVETICR YNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVP PMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSL ADTTKPSLINIMIEPQATRKAQDFHWLTRSNM

Gene Information

• Gene Name: HACL1 2-hydroxyacyl-CoA lyase 1 [ Homo sapiens ]
• Official Symbol: HACL1
• Synonyms: HACL1; 2-hydroxyacyl-CoA lyase 1; 2 hydroxyphytanoyl CoA lyase , HPCL; 2 HPCL; PHYH2
• Gene ID: 26061
• mRNA Refseq: NM_012260
• Protein Refseq: NP_036392
• MIM: 604300
• Uniprot ID: Q9UJ83
• Chromosome Location: 3p24.3
• Pathway: Alpha-oxidation of phytanate, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Peroxisomal lipid metabolism, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem
• Function: carbon-carbon lyase activity; carbon-carbon lyase activity; identical protein binding; magnesium ion binding; thiamine pyrophosphate binding