Recombinant Human HACL1, His-tagged
Cat.No. : | HACL1-26022TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 393-578 of Human 2 Hydroxy phytanoyl CoA lyase with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 393-578 a.a. |
Description : | By analyzing 1,780,295 5-end sequences of human full-length cDNAs derived from 164 kinds of oligo-cap cDNA libraries, we identified 269,774 independent positions of transcriptional start sites (TSSs) for 14,628 human RefSeq genes. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGF AIAAAVVAKDRSPGQWIICVEGDSAFGFSGMEVETICR YNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVP PMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSL ADTTKPSLINIMIEPQATRKAQDFHWLTRSNM |
Gene Name | HACL1 2-hydroxyacyl-CoA lyase 1 [ Homo sapiens ] |
Official Symbol | HACL1 |
Synonyms | HACL1; 2-hydroxyacyl-CoA lyase 1; 2 hydroxyphytanoyl CoA lyase , HPCL; 2 HPCL; PHYH2; |
Gene ID | 26061 |
mRNA Refseq | NM_012260 |
Protein Refseq | NP_036392 |
MIM | 604300 |
Uniprot ID | Q9UJ83 |
Chromosome Location | 3p24.3 |
Pathway | Alpha-oxidation of phytanate, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Peroxisomal lipid metabolism, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; |
Function | carbon-carbon lyase activity; carbon-carbon lyase activity; identical protein binding; magnesium ion binding; thiamine pyrophosphate binding; |
◆ Recombinant Proteins | ||
Hacl1-1611M | Recombinant Mouse Hacl1 Protein, His-tagged | +Inquiry |
HACL1-13656H | Recombinant Human HACL1, His-tagged | +Inquiry |
Hacl1-1612R | Recombinant Rat Hacl1 Protein, His-tagged | +Inquiry |
HACL1-12313Z | Recombinant Zebrafish HACL1 | +Inquiry |
HACL1-33H | Recombinant Human HACL1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HACL1-5647HCL | Recombinant Human HACL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HACL1 Products
Required fields are marked with *
My Review for All HACL1 Products
Required fields are marked with *
0
Inquiry Basket