Recombinant Human HADH
Cat.No. : | HADH-27760TH |
Product Overview : | Recombinant Full Length Human HADHSC produced in Saccharomyces cerevisiae; 314 amino acids, MWt 34.3 kDa. 25 kDa proprietary tag is attached. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. |
Tissue specificity : | Expressed in liver, kidney, pancreas, heart and skeletal muscle. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGA GIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVA KKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSI ANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTF ESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKF IVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGF YKYK |
Sequence Similarities : | Belongs to the 3-hydroxyacyl-CoA dehydrogenase family. |
Full Length : | Full L. |
Gene Name | HADH hydroxyacyl-CoA dehydrogenase [ Homo sapiens ] |
Official Symbol | HADH |
Synonyms | HADH; hydroxyacyl-CoA dehydrogenase; HADHSC, hydroxyacyl Coenzyme A dehydrogenase , L 3 hydroxyacyl Coenzyme A dehydrogenase, short chain; hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HADH1; SCHAD; |
Gene ID | 3033 |
mRNA Refseq | NM_001184705 |
Protein Refseq | NP_001171634 |
MIM | 601609 |
Uniprot ID | Q16836 |
Chromosome Location | 4q22-q26 |
Pathway | Beta oxidation of butanoyl-CoA to acetyl-CoA, organism-specific biosystem; Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of hexanoyl-CoA to butanoyl-CoA, organism-specific biosystem; Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of octanoyl-CoA to hexanoyl-CoA, organism-specific biosystem; |
Function | 3-hydroxyacyl-CoA dehydrogenase activity; NAD+ binding; coenzyme binding; nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
HADH-1041H | Recombinant Human HADH Protein, His (Fc)-Avi-tagged | +Inquiry |
Hadh-1613R | Recombinant Rat Hadh Protein, His-tagged | +Inquiry |
HADH-4557H | Recombinant Human HADH Protein, GST-tagged | +Inquiry |
HADH-3446HF | Recombinant Full Length Human HADH Protein, GST-tagged | +Inquiry |
HADH-4051M | Recombinant Mouse HADH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HADH-5646HCL | Recombinant Human HADH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HADH Products
Required fields are marked with *
My Review for All HADH Products
Required fields are marked with *