"HAMP" Related Products

Expand
Expand
Expand

Recombinant Human HAMP protein, GST-tagged

Cat.No.: HAMP-280H
Product Overview: Recombinant Human HAMP fused with GST tag at N-terminal was expressed in E. coli.
Description: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure.
Source: E. coli
Species: Human
Tag: GST
Form: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
Molecular Mass: 2.92kD
AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYI ADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRG SENLYFQGHMDTHFPICIFCCGCCHRSKCG
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name: HAMP hepcidin antimicrobial peptide [ Homo sapiens ]
Official Symbol: HAMP
Synonyms: HAMP; hepcidin antimicrobial peptide; hepcidin; HEPC; HFE2B; LEAP 1; LEAP1; putative liver tumor regressor; liver-expressed antimicrobial peptide 1; PLTR;
Gene ID: 57817
mRNA Refseq: NM_021175
Protein Refseq: NP_066998
MIM: 606464
UniProt ID: P81172
Chromosome Location: 19q13.1
Function: hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.