Recombinant Human HAND1 Protein, GST-tagged

Cat.No. : HAND1-4566H
Product Overview : Human HAND1 full-length ORF ( ABZ92217.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq
Molecular Mass : 23.7 kDa
AA Sequence : MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAND1 heart and neural crest derivatives expressed 1 [ Homo sapiens ]
Official Symbol HAND1
Synonyms HAND1; heart and neural crest derivatives expressed 1; heart- and neural crest derivatives-expressed protein 1; bHLHa27; eHand; Hxt; Thing1; class A basic helix-loop-helix protein 27; extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1;
Gene ID 9421
mRNA Refseq NM_004821
Protein Refseq NP_004812
MIM 602406
UniProt ID O96004

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAND1 Products

Required fields are marked with *

My Review for All HAND1 Products

Required fields are marked with *

0
cart-icon