Recombinant Human HAPLN2 Protein, GST-tagged
Cat.No. : | HAPLN2-4575H |
Product Overview : | Human HAPLN2 full-length ORF (BAG52217.1, 1 a.a. - 340 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HAPLN2 (Hyaluronan And Proteoglycan Link Protein 2) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN3. |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAPLN2 hyaluronan and proteoglycan link protein 2 [ Homo sapiens ] |
Official Symbol | HAPLN2 |
Synonyms | BRAL1 |
Gene ID | 60484 |
mRNA Refseq | NM_021817 |
Protein Refseq | NP_068589 |
UniProt ID | Q9GZV7 |
◆ Recombinant Proteins | ||
HAPLN2-3016H | Recombinant Human HAPLN2 protein, His-tagged | +Inquiry |
HAPLN2-2444R | Recombinant Rat HAPLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAPLN2-2035R | Recombinant Rhesus monkey HAPLN2 Protein, His-tagged | +Inquiry |
HAPLN2-2227H | Recombinant Human HAPLN2 protein, His-tagged | +Inquiry |
HAPLN2-4575H | Recombinant Human HAPLN2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAPLN2 Products
Required fields are marked with *
My Review for All HAPLN2 Products
Required fields are marked with *
0
Inquiry Basket