Recombinant Human HAPLN3 protein, His-tagged
| Cat.No. : | HAPLN3-5672H |
| Product Overview : | Recombinant Human HAPLN3 protein(20-138 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-138 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | FYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HAPLN3 hyaluronan and proteoglycan link protein 3 [ Homo sapiens ] |
| Official Symbol | HAPLN3 |
| Synonyms | HAPLN3; hyaluronan and proteoglycan link protein 3; EXLD1, extracellular link domain containing, 1; HsT19883; extracellular link domain containing, 1; EXLD1; |
| Gene ID | 145864 |
| mRNA Refseq | NM_178232 |
| Protein Refseq | NP_839946 |
| UniProt ID | Q96S86 |
| ◆ Recombinant Proteins | ||
| HAPLN3-13667H | Recombinant Human HAPLN3, His-tagged | +Inquiry |
| HAPLN3-7480M | Recombinant Mouse HAPLN3 Protein | +Inquiry |
| HAPLN3-4577H | Recombinant Human HAPLN3 Protein, GST-tagged | +Inquiry |
| HAPLN3-4056M | Recombinant Mouse HAPLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HAPLN3-5672H | Recombinant Human HAPLN3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAPLN3-5636HCL | Recombinant Human HAPLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN3 Products
Required fields are marked with *
My Review for All HAPLN3 Products
Required fields are marked with *
