Recombinant Human HAPLN3 protein, His-tagged
Cat.No. : | HAPLN3-5672H |
Product Overview : | Recombinant Human HAPLN3 protein(20-138 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-138 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | FYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HAPLN3 hyaluronan and proteoglycan link protein 3 [ Homo sapiens ] |
Official Symbol | HAPLN3 |
Synonyms | HAPLN3; hyaluronan and proteoglycan link protein 3; EXLD1, extracellular link domain containing, 1; HsT19883; extracellular link domain containing, 1; EXLD1; |
Gene ID | 145864 |
mRNA Refseq | NM_178232 |
Protein Refseq | NP_839946 |
UniProt ID | Q96S86 |
◆ Recombinant Proteins | ||
HAPLN3-2228H | Recombinant Human HAPLN3 protein, His-tagged | +Inquiry |
Hapln3-4295M | Recombinant Mouse Hapln3 protein, His&Myc-tagged | +Inquiry |
Hapln3-4294M | Recombinant Mouse Hapln3 protein, His&Myc-tagged | +Inquiry |
HAPLN3-5672H | Recombinant Human HAPLN3 protein, His-tagged | +Inquiry |
HAPLN3-7480M | Recombinant Mouse HAPLN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAPLN3-5636HCL | Recombinant Human HAPLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN3 Products
Required fields are marked with *
My Review for All HAPLN3 Products
Required fields are marked with *
0
Inquiry Basket