Recombinant Human HARS2 Protein, GST-tagged
| Cat.No. : | HARS2-4582H |
| Product Overview : | Human HARSL partial ORF ( NP_036340, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HARS2 histidyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
| Official Symbol | HARS2 |
| Synonyms | HARS2; histidyl-tRNA synthetase 2, mitochondrial (putative); HARSL, histidyl tRNA synthetase like; probable histidine--tRNA ligase, mitochondrial; HARSR; histidine tRNA ligase 2; mitochondrial (putative); HO3; hisRS; HARS-related; histidine translase; histidine-tRNA ligase homolog; probable histidyl-tRNA synthetase, mitochondrial; histidine tRNA ligase 2, mitochondrial (putative); HARSL; |
| Gene ID | 23438 |
| mRNA Refseq | NM_012208 |
| Protein Refseq | NP_036340 |
| MIM | 600783 |
| UniProt ID | P49590 |
| ◆ Recombinant Proteins | ||
| HARS2-7484M | Recombinant Mouse HARS2 Protein | +Inquiry |
| HARS2-1044H | Recombinant Human HARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HARS2-13670H | Recombinant Human HARS2, GST-tagged | +Inquiry |
| HARS2-4059M | Recombinant Mouse HARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hars2-3357M | Recombinant Mouse Hars2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HARS2-5634HCL | Recombinant Human HARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HARS2 Products
Required fields are marked with *
My Review for All HARS2 Products
Required fields are marked with *




