Recombinant Human HARS2 Protein, GST-tagged

Cat.No. : HARS2-4582H
Product Overview : Human HARSL partial ORF ( NP_036340, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HARS2 histidyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ]
Official Symbol HARS2
Synonyms HARS2; histidyl-tRNA synthetase 2, mitochondrial (putative); HARSL, histidyl tRNA synthetase like; probable histidine--tRNA ligase, mitochondrial; HARSR; histidine tRNA ligase 2; mitochondrial (putative); HO3; hisRS; HARS-related; histidine translase; histidine-tRNA ligase homolog; probable histidyl-tRNA synthetase, mitochondrial; histidine tRNA ligase 2, mitochondrial (putative); HARSL;
Gene ID 23438
mRNA Refseq NM_012208
Protein Refseq NP_036340
MIM 600783
UniProt ID P49590

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HARS2 Products

Required fields are marked with *

My Review for All HARS2 Products

Required fields are marked with *

0
cart-icon