Recombinant Human HAS2 Protein, GST-tagged
Cat.No. : | HAS2-4584H |
Product Overview : | Human HAS2 partial ORF ( NP_005319, 102 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extruded through pore-like structures into the extracellular space. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serum concentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. In addition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes, and overexpression of HA receptors has been correlated with tumor metastasis. HAS2 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to glycosaminoglycan synthetase (DG42) from Xenopus laevis, and human and murine hyaluronan synthase 1. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAS2 hyaluronan synthase 2 [ Homo sapiens (human) ] |
Official Symbol | HAS2 |
Synonyms | HAS2; hyaluronan synthase 2; hyaluronan synthase 2; HA synthase 2; hyaluronate synthase 2; hyaluronic acid synthase 2; EC 2.4.1.212 |
Gene ID | 3037 |
mRNA Refseq | NM_005328 |
Protein Refseq | NP_005319 |
MIM | 601636 |
UniProt ID | Q92819 |
◆ Recombinant Proteins | ||
HAS2-2230H | Recombinant Human HAS2 Protein, His-tagged | +Inquiry |
RFL6640RF | Recombinant Full Length Rat Hyaluronan Synthase 2(Has2) Protein, His-Tagged | +Inquiry |
Has2-2756R | Recombinant Rat Has2 Protein, His-tagged | +Inquiry |
HAS2-2446R | Recombinant Rat HAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAS2-2792R | Recombinant Rat HAS2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAS2 Products
Required fields are marked with *
My Review for All HAS2 Products
Required fields are marked with *