Recombinant Human HAUS2 Protein, GST-tagged

Cat.No. : HAUS2-5173H
Product Overview : Human CEP27 full-length ORF ( NP_060567.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. [provided by RefSeq, Apr 2016]
Molecular Mass : 53.3 kDa
AA Sequence : MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAUS2 HAUS augmin like complex subunit 2 [ Homo sapiens (human) ]
Official Symbol HAUS2
Synonyms HAUS2; HAUS augmin like complex subunit 2; CEP27; C15orf25; HsT17025; HAUS augmin-like complex subunit 2; centrosomal protein 27kDa; centrosomal protein of 27 kDa
Gene ID 55142
mRNA Refseq NM_001130447
Protein Refseq NP_001123919
MIM 613429
UniProt ID Q9NVX0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAUS2 Products

Required fields are marked with *

My Review for All HAUS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon