Recombinant Human HAUS2 Protein, GST-tagged

• Cat.No.: HAUS2-5173H
• Product Overview: Human CEP27 full-length ORF ( NP_060567.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. [provided by RefSeq, Apr 2016]
• Molecular Mass: 53.3 kDa
• AA Sequence: MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAUS2 HAUS augmin like complex subunit 2 [ Homo sapiens (human) ]
• Official Symbol: HAUS2
• Synonyms: HAUS2; HAUS augmin like complex subunit 2; CEP27; C15orf25; HsT17025; HAUS augmin-like complex subunit 2; centrosomal protein 27kDa; centrosomal protein of 27 kDa
• Gene ID: 55142
• mRNA Refseq: NM_001130447
• Protein Refseq: NP_001123919
• MIM: 613429
• UniProt ID: Q9NVX0