Recombinant Human HAVCR2 protein, T7/His-tagged
| Cat.No. : | HAVCR2-175H |
| Product Overview : | Recombinant human TIM3 cDNA (22 – 202 aa, derived from BC063431) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 22-202 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVV LRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQR DFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIG |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ] |
| Official Symbol | HAVCR2 |
| Synonyms | HAVCR2; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; KIM-3; Tim-3; TIMD-3; HAVcr-2; |
| Gene ID | 84868 |
| mRNA Refseq | NM_032782 |
| Protein Refseq | NP_116171 |
| MIM | 606652 |
| UniProt ID | Q8TDQ0 |
| Chromosome Location | 5q34 |
| ◆ Recombinant Proteins | ||
| HAVCR2-111H | Recombinant Human HAVCR2 Protein (ECD), His-tagged(C-ter) | +Inquiry |
| HAVCR2-529MAF647 | Recombinant Mouse Havcr2 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| HAVCR2-213CAF555 | Recombinant Monkey HAVCR2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| HAVCR2-877HAF647 | Recombinant Human HAVCR2 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| HAVCR2-0760C | Recombinant Canine HAVCR2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
| HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAVCR2 Products
Required fields are marked with *
My Review for All HAVCR2 Products
Required fields are marked with *




