Recombinant Human HAVCR2 protein, T7/His-tagged

Cat.No. : HAVCR2-175H
Product Overview : Recombinant human TIM3 cDNA (22 – 202 aa, derived from BC063431) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 22-202 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVV LRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQR DFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIG
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ]
Official Symbol HAVCR2
Synonyms HAVCR2; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; KIM-3; Tim-3; TIMD-3; HAVcr-2;
Gene ID 84868
mRNA Refseq NM_032782
Protein Refseq NP_116171
MIM 606652
UniProt ID Q8TDQ0
Chromosome Location 5q34

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAVCR2 Products

Required fields are marked with *

My Review for All HAVCR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon