Recombinant Human HAVCR2 protein, T7/His-tagged
Cat.No. : | HAVCR2-175H |
Product Overview : | Recombinant human TIM3 cDNA (22 – 202 aa, derived from BC063431) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-202 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVV LRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQR DFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIG |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ] |
Official Symbol | HAVCR2 |
Synonyms | HAVCR2; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; KIM-3; Tim-3; TIMD-3; HAVcr-2; |
Gene ID | 84868 |
mRNA Refseq | NM_032782 |
Protein Refseq | NP_116171 |
MIM | 606652 |
UniProt ID | Q8TDQ0 |
Chromosome Location | 5q34 |
◆ Recombinant Proteins | ||
HAVCR2-876H | Recombinant Human HAVCR2 protein, Fc-tagged | +Inquiry |
HAVCR2-213C | Recombinant Cynomolgus HAVCR2 protein(Met1-Arg201), hFc-tagged | +Inquiry |
HAVCR2-704H | Active Recombinant Human HAVCR2, Fc-tagged, Biotinylated | +Inquiry |
HAVCR2-529MAF555 | Recombinant Mouse Havcr2 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
HAVCR2-051H | Active Recombinant Human HAVCR2 protein, His/Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAVCR2 Products
Required fields are marked with *
My Review for All HAVCR2 Products
Required fields are marked with *
0
Inquiry Basket