Recombinant Human HBB Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | HBB-094H |
Product Overview : | HBB MS Standard C13 and N15-labeled recombinant protein (NP_000509) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
Molecular Mass : | 16 kDa |
AA Sequence : | MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HBB hemoglobin subunit beta [ Homo sapiens (human) ] |
Official Symbol | HBB |
Synonyms | HBB; hemoglobin subunit beta; beta-globin; CD113t-C; ECYT6; hemoglobin subunit beta; beta globin chain; hemoglobin beta subunit; hemoglobin, beta |
Gene ID | 3043 |
mRNA Refseq | NM_000518 |
Protein Refseq | NP_000509 |
MIM | 141900 |
UniProt ID | P68871 |
◆ Recombinant Proteins | ||
HBB-2441H | Recombinant Human HBB Protein (Met1-His147), N-His tagged | +Inquiry |
HBB-585C | Recombinant Cynomolgus HBB Protein, His-tagged | +Inquiry |
HBB-7863H | Recombinant Horse HBB protein, His & T7-tagged | +Inquiry |
HBB-7865H | Recombinant Human HBB protein, His & GST-tagged | +Inquiry |
HBB-2799R | Recombinant Rat HBB Protein | +Inquiry |
◆ Native Proteins | ||
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBB-5622HCL | Recombinant Human HBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBB Products
Required fields are marked with *
My Review for All HBB Products
Required fields are marked with *