Recombinant Human HBB Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : HBB-094H
Product Overview : HBB MS Standard C13 and N15-labeled recombinant protein (NP_000509) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Molecular Mass : 16 kDa
AA Sequence : MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HBB hemoglobin subunit beta [ Homo sapiens (human) ]
Official Symbol HBB
Synonyms HBB; hemoglobin subunit beta; beta-globin; CD113t-C; ECYT6; hemoglobin subunit beta; beta globin chain; hemoglobin beta subunit; hemoglobin, beta
Gene ID 3043
mRNA Refseq NM_000518
Protein Refseq NP_000509
MIM 141900
UniProt ID P68871

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBB Products

Required fields are marked with *

My Review for All HBB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon