Recombinant Human HBG2 Protein, GST-tagged
Cat.No. : | HBG2-4603H |
Product Overview : | Human HBG2 full-length ORF (AAH10914.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5- epsilon -- gamma-G -- gamma-A -- delta -- beta--3. [provided by RefSeq |
Molecular Mass : | 42.57 kDa |
AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HBG2 hemoglobin subunit gamma 2 [ Homo sapiens (human) ] |
Official Symbol | HBG2 |
Synonyms | HBG2; hemoglobin subunit gamma 2; TNCY; HBG-T1; hemoglobin subunit gamma-2; G-gamma globin Paulinia; abnormal hemoglobin; gamma-2-globin; hb F Ggamma; hemoglobin gamma-2 chain; hemoglobin gamma-G chain; hemoglobin, gamma G; methemoglobin |
Gene ID | 3048 |
mRNA Refseq | NM_000184 |
Protein Refseq | NP_000175 |
MIM | 142250 |
UniProt ID | P69892 |
◆ Recombinant Proteins | ||
HBG2-3021H | Recombinant Human HBG2 protein, His&Myc-tagged | +Inquiry |
HBG2-2168HFL | Recombinant Full Length Human HBG2 Protein, C-Flag-tagged | +Inquiry |
HBG2-1049H | Recombinant Human HBG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HBG2-3495HF | Recombinant Full Length Human HBG2 Protein, GST-tagged | +Inquiry |
HBG2-4603H | Recombinant Human HBG2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBG2-5619HCL | Recombinant Human HBG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG2 Products
Required fields are marked with *
My Review for All HBG2 Products
Required fields are marked with *
0
Inquiry Basket