Recombinant Human HCCS Protein, GST-tagged
Cat.No. : | HCCS-4615H |
Product Overview : | Human HCCS full-length ORF ( AAH01691, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 55.22 kDa |
AA Sequence : | MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCRTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HCCS holocytochrome c synthase [ Homo sapiens ] |
Official Symbol | HCCS |
Synonyms | HCCS; holocytochrome c synthase; holocytochrome c synthase (cytochrome c heme lyase); cytochrome c-type heme lyase; CCHL; cytochrome c heme lyase; cytochrome c heme-lyase; holocytochrome c-type synthase; MCOPS7; DKFZp779I1858; |
Gene ID | 3052 |
mRNA Refseq | NM_001122608 |
Protein Refseq | NP_001116080 |
MIM | 300056 |
UniProt ID | P53701 |
◆ Recombinant Proteins | ||
HCCS-1059H | Recombinant Human HCCS Protein, MYC/DDK-tagged | +Inquiry |
Hccs-1099M | Recombinant Mouse Hccs Protein, MYC/DDK-tagged | +Inquiry |
HCCS-3024H | Recombinant Human HCCS protein, GST-tagged | +Inquiry |
HCCS-3504HF | Recombinant Full Length Human HCCS Protein, GST-tagged | +Inquiry |
HCCS-13691H | Recombinant Human HCCS, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCCS-773HCL | Recombinant Human HCCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HCCS Products
Required fields are marked with *
My Review for All HCCS Products
Required fields are marked with *
0
Inquiry Basket