Recombinant Human HCCS protein, GST-tagged
Cat.No. : | HCCS-3024H |
Product Overview : | Recombinant Human HCCS protein(P53701)(1-268aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-268aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HCCS holocytochrome c synthase [ Homo sapiens ] |
Official Symbol | HCCS |
Synonyms | HCCS; holocytochrome c synthase; holocytochrome c synthase (cytochrome c heme lyase); cytochrome c-type heme lyase; CCHL; cytochrome c heme lyase; cytochrome c heme-lyase; holocytochrome c-type synthase; MCOPS7; DKFZp779I1858; |
Gene ID | 3052 |
mRNA Refseq | NM_001122608 |
Protein Refseq | NP_001116080 |
MIM | 300056 |
UniProt ID | P53701 |
◆ Recombinant Proteins | ||
HCCS-1059H | Recombinant Human HCCS Protein, MYC/DDK-tagged | +Inquiry |
HCCS-1652H | Recombinant Human HCCS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hccs-1099M | Recombinant Mouse Hccs Protein, MYC/DDK-tagged | +Inquiry |
HCCS-3504HF | Recombinant Full Length Human HCCS Protein, GST-tagged | +Inquiry |
HCCS-3024H | Recombinant Human HCCS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCCS-773HCL | Recombinant Human HCCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCCS Products
Required fields are marked with *
My Review for All HCCS Products
Required fields are marked with *