Recombinant Human HCCS protein, GST-tagged

Cat.No. : HCCS-3024H
Product Overview : Recombinant Human HCCS protein(P53701)(1-268aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-268aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 57.6 kDa
AA Sequence : MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HCCS holocytochrome c synthase [ Homo sapiens ]
Official Symbol HCCS
Synonyms HCCS; holocytochrome c synthase; holocytochrome c synthase (cytochrome c heme lyase); cytochrome c-type heme lyase; CCHL; cytochrome c heme lyase; cytochrome c heme-lyase; holocytochrome c-type synthase; MCOPS7; DKFZp779I1858;
Gene ID 3052
mRNA Refseq NM_001122608
Protein Refseq NP_001116080
MIM 300056
UniProt ID P53701

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCCS Products

Required fields are marked with *

My Review for All HCCS Products

Required fields are marked with *

0
cart-icon