Recombinant Full Length Human HCCS Protein, GST-tagged

Cat.No. : HCCS-3504HF
Product Overview : Human HCCS full-length ORF ( AAH01691, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 268 amino acids
Description : The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]
Molecular Mass : 55.22 kDa
AA Sequence : MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCRTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCCS holocytochrome c synthase [ Homo sapiens ]
Official Symbol HCCS
Synonyms HCCS; holocytochrome c synthase; holocytochrome c synthase (cytochrome c heme lyase); cytochrome c-type heme lyase; CCHL; cytochrome c heme lyase; cytochrome c heme-lyase; holocytochrome c-type synthase; MCOPS7; DKFZp779I1858;
Gene ID 3052
mRNA Refseq NM_001122608
Protein Refseq NP_001116080
MIM 300056
UniProt ID P53701

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCCS Products

Required fields are marked with *

My Review for All HCCS Products

Required fields are marked with *

0
cart-icon