Recombinant Full Length Human HCCS Protein, GST-tagged

• Cat.No.: HCCS-3504HF
• Product Overview: Human HCCS full-length ORF ( AAH01691, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 268 amino acids
• Description: The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]
• Molecular Mass: 55.22 kDa
• AA Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCRTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HCCS holocytochrome c synthase [ Homo sapiens ]
• Official Symbol: HCCS
• Synonyms: HCCS; holocytochrome c synthase; holocytochrome c synthase (cytochrome c heme lyase); cytochrome c-type heme lyase; CCHL; cytochrome c heme lyase; cytochrome c heme-lyase; holocytochrome c-type synthase; MCOPS7; DKFZp779I1858
• Gene ID: 3052
• mRNA Refseq: NM_001122608
• Protein Refseq: NP_001116080
• MIM: 300056
• UniProt ID: P53701