Recombinant Human HCLS1 Protein, His-tagged
Cat.No. : | HCLS1-001H |
Product Overview : | Recombinant Human HCLS1 Protein, His-tagged, expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-84 aa |
Tag : | His |
Molecular Mass : | 11 kDa |
AA Sequence : | MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.68mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens (human) ] |
Official Symbol | HCLS1 |
Synonyms | HS1; p75; CTTNL; lckBP1; HCLS1 |
Gene ID | 3059 |
MIM | 601306 |
UniProt ID | P14317 |
◆ Recombinant Proteins | ||
HCLS1-4081M | Recombinant Mouse HCLS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HCLS1-4628H | Recombinant Human HCLS1 Protein, GST-tagged | +Inquiry |
HCLS1-001H | Recombinant Human HCLS1 Protein, His-tagged | +Inquiry |
HCLS1-3052C | Recombinant Chicken HCLS1 | +Inquiry |
HCLS1-223HF | Recombinant Full Length Human HCLS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCLS1-5611HCL | Recombinant Human HCLS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCLS1 Products
Required fields are marked with *
My Review for All HCLS1 Products
Required fields are marked with *