Recombinant Human HCLS1 Protein, His-tagged

• Cat.No.: HCLS1-001H
• Product Overview: Recombinant Human HCLS1 Protein, His-tagged, expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-84 aa
• Tag: His
• Molecular Mass: 11 kDa
• AA Sequence: MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.68mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens (human) ]
• Official Symbol: HCLS1
• Synonyms: HS1; p75; CTTNL; lckBP1; HCLS1
• Gene ID: 3059
• MIM: 601306
• UniProt ID: P14317