Recombinant Human HDAC4, His-tagged
| Cat.No. : | HDAC4-28266TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 556-1084 of Human HDAC4 with a N terminal His tag; MWt 85 kDa: |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 556-1084 a.a. |
| Description : | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitous. |
| Form : | Lyophilised:reconstitution with 125 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQAL LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSS PASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGS SSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEEL QTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRL PCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVAT GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLL QQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRY DDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMG DAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPT PLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEK VMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVT AMASLSVGVKPAEKRPDEEPMEEEPPL |
| Sequence Similarities : | Belongs to the histone deacetylase family. HD type 2 subfamily. |
| Gene Name | HDAC4 histone deacetylase 4 [ Homo sapiens ] |
| Official Symbol | HDAC4 |
| Synonyms | HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288; |
| Gene ID | 9759 |
| mRNA Refseq | NM_006037 |
| Protein Refseq | NP_006028 |
| MIM | 605314 |
| Uniprot ID | P56524 |
| Chromosome Location | 2q37.3 |
| Pathway | Cell cycle, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class II, organism-specific biosystem; |
| Function | NAD-dependent histone deacetylase activity (H3-K14 specific); NAD-dependent histone deacetylase activity (H3-K9 specific); NAD-dependent histone deacetylase activity (H4-K16 specific); activating transcription factor binding; histone deacetylase activity; |
| ◆ Recombinant Proteins | ||
| HDAC423292H | Recombinant Human HDAC4 (648-1057) Protein | +Inquiry |
| HDAC4-2817R | Recombinant Rat HDAC4 Protein | +Inquiry |
| HDAC4-28266TH | Recombinant Human HDAC4, His-tagged | +Inquiry |
| HDAC4-2472R | Recombinant Rat HDAC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDAC4-1592H | Recombinant Human Distone Deacetylase 4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDAC4-001HCL | Recombinant Human HDAC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC4 Products
Required fields are marked with *
My Review for All HDAC4 Products
Required fields are marked with *
