Recombinant Human HDAC4 protein(91-320 aa), C-His-tagged
Cat.No. : | HDAC4-2793H |
Product Overview : | Recombinant Human HDAC4 protein(P56524)(91-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-320 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAV |
Gene Name | HDAC4 histone deacetylase 4 [ Homo sapiens ] |
Official Symbol | HDAC4 |
Synonyms | HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288; histone deacetylase A; AHO3; BDMR; HDAC-4; HDAC-A; |
Gene ID | 9759 |
mRNA Refseq | NM_006037 |
Protein Refseq | NP_006028 |
MIM | 605314 |
UniProt ID | P56524 |
◆ Recombinant Proteins | ||
HDAC423292H | Recombinant Human HDAC4 (648-1057) Protein | +Inquiry |
HDAC4-4091M | Recombinant Mouse HDAC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hdac4-3369M | Recombinant Mouse Hdac4 Protein, Myc/DDK-tagged | +Inquiry |
HDAC4-1054H | Recombinant Human HDAC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDAC4-95H | Recombinant Human HDAC4 Protein, GST/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC4-001HCL | Recombinant Human HDAC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC4 Products
Required fields are marked with *
My Review for All HDAC4 Products
Required fields are marked with *