Recombinant Human HDAC4 protein(91-320 aa), C-His-tagged

• Cat.No.: HDAC4-2793H
• Product Overview: Recombinant Human HDAC4 protein(P56524)(91-320 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-320 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAV

Gene Information

• Gene Name: HDAC4 histone deacetylase 4 [ Homo sapiens ]
• Official Symbol: HDAC4
• Synonyms: HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288; histone deacetylase A; AHO3; BDMR; HDAC-4; HDAC-A
• Gene ID: 9759
• mRNA Refseq: NM_006037
• Protein Refseq: NP_006028
• MIM: 605314
• UniProt ID: P56524