Recombinant Human HDAC4 protein(91-320 aa), C-His-tagged
| Cat.No. : | HDAC4-2793H |
| Product Overview : | Recombinant Human HDAC4 protein(P56524)(91-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-320 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAV |
| Gene Name | HDAC4 histone deacetylase 4 [ Homo sapiens ] |
| Official Symbol | HDAC4 |
| Synonyms | HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288; histone deacetylase A; AHO3; BDMR; HDAC-4; HDAC-A; |
| Gene ID | 9759 |
| mRNA Refseq | NM_006037 |
| Protein Refseq | NP_006028 |
| MIM | 605314 |
| UniProt ID | P56524 |
| ◆ Recombinant Proteins | ||
| HDAC4-2472R | Recombinant Rat HDAC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDAC4-4091M | Recombinant Mouse HDAC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDAC4-2793H | Recombinant Human HDAC4 protein(91-320 aa), C-His-tagged | +Inquiry |
| HDAC429133H | Recombinant Human HDAC4 (648-1057) Protein | +Inquiry |
| HDAC4-28266TH | Recombinant Human HDAC4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDAC4-001HCL | Recombinant Human HDAC4 cell lysate | +Inquiry |
| HDAC4-197HKCL | Human HDAC4 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC4 Products
Required fields are marked with *
My Review for All HDAC4 Products
Required fields are marked with *
