Recombinant Human HDAC6 Protein, GST-tagged
Cat.No. : | HDAC6-4648H |
Product Overview : | Human HDAC6 partial ORF ( NP_006035, 1128 a.a. - 1215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq |
Molecular Mass : | 35.42 kDa |
AA Sequence : | DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDAC6 histone deacetylase 6 [ Homo sapiens ] |
Official Symbol | HDAC6 |
Synonyms | HDAC6; histone deacetylase 6; FLJ16239; HD6; JM21; KIAA0901; |
Gene ID | 10013 |
mRNA Refseq | NM_006044 |
Protein Refseq | NP_006035 |
MIM | 300272 |
UniProt ID | Q9UBN7 |
◆ Recombinant Proteins | ||
HDAC6-401H | Active Recombinant Human Histone Deacetylase 6, His-tagged | +Inquiry |
HDAC6-132H | Recombinant Human HDAC6 protein, His-tagged | +Inquiry |
Hdac6-1371R | Recombinant Rat Hdac6 protein, His & T7-tagged | +Inquiry |
HDAC6-28922TH | Recombinant Human HDAC6 | +Inquiry |
HDAC6-397H | Active Recombinant Human Histone Deacetylase 6, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC6-5603HCL | Recombinant Human HDAC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC6 Products
Required fields are marked with *
My Review for All HDAC6 Products
Required fields are marked with *