"HDAC6" Related Products

Expand
Expand

Recombinant Human HDAC6 Protein, GST-tagged

Cat.No. : HDAC6-4648H
Product Overview : Human HDAC6 partial ORF ( NP_006035, 1128 a.a. - 1215 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 35.42 kDa
AA Sequence : DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : HDAC6 histone deacetylase 6 [ Homo sapiens ]
Official Symbol : HDAC6
Synonyms : HDAC6; histone deacetylase 6; FLJ16239; HD6; JM21; KIAA0901;
Gene ID : 10013
mRNA Refseq : NM_006044
Protein Refseq : NP_006035
MIM : 300272
UniProt ID : Q9UBN7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.