Recombinant Human HDAC6 protein, His-SUMO-tagged
Cat.No. : | HDAC6-3025H |
Product Overview : | Recombinant Human HDAC6 protein(Q9UBN7)(1-488aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-488aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.1 kDa |
AA Sequence : | MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HDAC6 histone deacetylase 6 [ Homo sapiens ] |
Official Symbol | HDAC6 |
Synonyms | HDAC6; histone deacetylase 6; FLJ16239; HD6; JM21; KIAA0901; |
Gene ID | 10013 |
mRNA Refseq | NM_006044 |
Protein Refseq | NP_006035 |
MIM | 300272 |
UniProt ID | Q9UBN7 |
◆ Recombinant Proteins | ||
HDAC6-2056R | Recombinant Rhesus monkey HDAC6 Protein, His-tagged | +Inquiry |
HDAC6-38MFL | Active Recombinant Full Length Macaca fascicularis HDAC6 Protein, N-GST-tagged | +Inquiry |
HDAC6-3025H | Recombinant Human HDAC6 protein, His-SUMO-tagged | +Inquiry |
HDAC6-1359H | Active Recombinant Human HDAC6, GST-tagged | +Inquiry |
HDAC6-255HFL | Recombinant Full Length Human HDAC6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC6-5603HCL | Recombinant Human HDAC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDAC6 Products
Required fields are marked with *
My Review for All HDAC6 Products
Required fields are marked with *
0
Inquiry Basket