Recombinant Human HDAC7 protein(447-530 aa), His-tagged

Cat.No. : HDAC7-13710H
Product Overview : Recombinant Human HDAC7 protein(447-530 aa) was expressed in E. coli, with a polyhistidine tag at the N-terminus.
Availability August 20, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 447-530 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
Gene Name HDAC7 histone deacetylase 7 [ Homo sapiens ]
Official Symbol HDAC7
Synonyms HDAC7; histone deacetylase 7; HDAC7A, histone deacetylase 7A; DKFZP586J0917; HD7; histone deacetylase 7A; HD7A; HDAC7A; FLJ99588; DKFZp586J0917;
Gene ID 51564
mRNA Refseq NM_001098416
Protein Refseq NP_001091886
MIM 606542
UniProt ID Q8WUI4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDAC7 Products

Required fields are marked with *

My Review for All HDAC7 Products

Required fields are marked with *

0
cart-icon
0
compare icon