Recombinant Human HDAC7 protein(447-530 aa), His-tagged
| Cat.No. : | HDAC7-13710H |
| Product Overview : | Recombinant Human HDAC7 protein(447-530 aa) was expressed in E. coli, with a polyhistidine tag at the N-terminus. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 447-530 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL |
| Gene Name | HDAC7 histone deacetylase 7 [ Homo sapiens ] |
| Official Symbol | HDAC7 |
| Synonyms | HDAC7; histone deacetylase 7; HDAC7A, histone deacetylase 7A; DKFZP586J0917; HD7; histone deacetylase 7A; HD7A; HDAC7A; FLJ99588; DKFZp586J0917; |
| Gene ID | 51564 |
| mRNA Refseq | NM_001098416 |
| Protein Refseq | NP_001091886 |
| MIM | 606542 |
| UniProt ID | Q8WUI4 |
| ◆ Recombinant Proteins | ||
| HDAC7-13710H | Recombinant Human HDAC7 protein(447-530 aa), His-tagged | +Inquiry |
| HDAC7-29191TH | Recombinant Human HDAC7 | +Inquiry |
| HDAC7-11H | Recombinant Human HDAC7 protein, MYC/DDK-tagged | +Inquiry |
| HDAC7-7534M | Recombinant Mouse HDAC7 Protein | +Inquiry |
| HDAC7-2692H | Recombinant Human HDAC7 Protein (482-903), His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC7 Products
Required fields are marked with *
My Review for All HDAC7 Products
Required fields are marked with *
