Recombinant Human HDAC9 protein, GST-tagged

• Cat.No.: HDAC9-301322H
• Product Overview: Recombinant Human HDAC9 (477-590 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gln477-Ile590
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: QYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: HDAC9 histone deacetylase 9 [ Homo sapiens ]
• Official Symbol: HDAC9
• Synonyms: HDAC9; histone deacetylase 9; HD7; HDAC; HDAC7B; KIAA0744; MITR; histone deacetylase 7B; histone deacetylase 4/5-related protein; MEF-2 interacting transcription repressor (MITR) protein; HD9; HD7b; HDRP; HDAC7; HDAC9B; HDAC9FL; DKFZp779K1053
• Gene ID: 9734
• mRNA Refseq: NM_001204144
• Protein Refseq: NP_001191073
• MIM: 606543
• UniProt ID: Q9UKV0