Recombinant Human HDAC9 protein, His-tagged
Cat.No. : | HDAC9-3152H |
Product Overview : | Recombinant Human HDAC9 protein(335-440 aa), fused to His tag, was expressed in E. coli. |
Availability | July 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 335-440 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HDAC9 histone deacetylase 9 [ Homo sapiens ] |
Official Symbol | HDAC9 |
Synonyms | HDAC9; histone deacetylase 9; HD7; HDAC; HDAC7B; KIAA0744; MITR; histone deacetylase 7B; histone deacetylase 4/5-related protein; MEF-2 interacting transcription repressor (MITR) protein; HD9; HD7b; HDRP; HDAC7; HDAC9B; HDAC9FL; DKFZp779K1053; |
Gene ID | 9734 |
mRNA Refseq | NM_001204144 |
Protein Refseq | NP_001191073 |
MIM | 606543 |
UniProt ID | Q9UKV0 |
◆ Recombinant Proteins | ||
HDAC9-4652H | Recombinant Human HDAC9 Protein, GST-tagged | +Inquiry |
HDAC9-3152H | Recombinant Human HDAC9 protein, His-tagged | +Inquiry |
Hdac9-3371M | Recombinant Mouse Hdac9 Protein, Myc/DDK-tagged | +Inquiry |
HDAC9-1303H | Recombinant Human HDAC9 Protein (814-1011 aa), His-tagged | +Inquiry |
HDAC9-1596H | Recombinant Human Histone Deacetylase 9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC9-5601HCL | Recombinant Human HDAC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC9 Products
Required fields are marked with *
My Review for All HDAC9 Products
Required fields are marked with *