Recombinant Human HDAC9 protein, His-tagged

Cat.No. : HDAC9-3152H
Product Overview : Recombinant Human HDAC9 protein(335-440 aa), fused to His tag, was expressed in E. coli.
Availability July 26, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 335-440 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HDAC9 histone deacetylase 9 [ Homo sapiens ]
Official Symbol HDAC9
Synonyms HDAC9; histone deacetylase 9; HD7; HDAC; HDAC7B; KIAA0744; MITR; histone deacetylase 7B; histone deacetylase 4/5-related protein; MEF-2 interacting transcription repressor (MITR) protein; HD9; HD7b; HDRP; HDAC7; HDAC9B; HDAC9FL; DKFZp779K1053;
Gene ID 9734
mRNA Refseq NM_001204144
Protein Refseq NP_001191073
MIM 606543
UniProt ID Q9UKV0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDAC9 Products

Required fields are marked with *

My Review for All HDAC9 Products

Required fields are marked with *

0
cart-icon