Recombinant Human HDDC2 Protein, GST-tagged
| Cat.No. : | HDDC2-4656H |
| Product Overview : | Human HDDC2 full-length ORF ( AAH66332.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HDDC2 (HD Domain Containing 2) is a Protein Coding gene. |
| Molecular Mass : | 49.8 kDa |
| AA Sequence : | MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HDDC2 HD domain containing 2 [ Homo sapiens ] |
| Official Symbol | HDDC2 |
| Synonyms | C6orf74; CGI-130; NS5ATP2; dJ167O5.2 |
| Gene ID | 51020 |
| mRNA Refseq | NM_016063 |
| Protein Refseq | NP_057147 |
| UniProt ID | Q7Z4H3 |
| ◆ Recombinant Proteins | ||
| HDDC2-5251C | Recombinant Chicken HDDC2 | +Inquiry |
| HDDC2-1878R | Recombinant Rhesus Macaque HDDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDDC2-3437HF | Recombinant Full Length Human HDDC2 Protein, GST-tagged | +Inquiry |
| Hddc2-3372M | Recombinant Mouse Hddc2 Protein, Myc/DDK-tagged | +Inquiry |
| HDDC2-519H | Recombinant Human HDDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDDC2-5599HCL | Recombinant Human HDDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDDC2 Products
Required fields are marked with *
My Review for All HDDC2 Products
Required fields are marked with *
