Recombinant Full Length Human HDDC2 Protein, GST-tagged

Cat.No. : HDDC2-3437HF
Product Overview : Human HDDC2 full-length ORF ( AAH66332.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 204 amino acids
Description : HDDC2 (HD Domain Containing 2) is a Protein Coding gene.
Molecular Mass : 49.8 kDa
AA Sequence : MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HDDC2 HD domain containing 2 [ Homo sapiens ]
Official Symbol HDDC2
Synonyms C6orf74; CGI-130; NS5ATP2; dJ167O5.2
Gene ID 51020
mRNA Refseq NM_016063
Protein Refseq NP_057147
UniProt ID Q7Z4H3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDDC2 Products

Required fields are marked with *

My Review for All HDDC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon