Recombinant Full Length Human HDDC2 Protein, GST-tagged
Cat.No. : | HDDC2-3437HF |
Product Overview : | Human HDDC2 full-length ORF ( AAH66332.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 204 amino acids |
Description : | HDDC2 (HD Domain Containing 2) is a Protein Coding gene. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDDC2 HD domain containing 2 [ Homo sapiens ] |
Official Symbol | HDDC2 |
Synonyms | C6orf74; CGI-130; NS5ATP2; dJ167O5.2 |
Gene ID | 51020 |
mRNA Refseq | NM_016063 |
Protein Refseq | NP_057147 |
UniProt ID | Q7Z4H3 |
◆ Recombinant Proteins | ||
HDDC2-13713H | Recombinant Human HDDC2, GST-tagged | +Inquiry |
HDDC2-5251C | Recombinant Chicken HDDC2 | +Inquiry |
HDDC2-1878R | Recombinant Rhesus Macaque HDDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDDC2-4095M | Recombinant Mouse HDDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDDC2-4656H | Recombinant Human HDDC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDDC2-5599HCL | Recombinant Human HDDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDDC2 Products
Required fields are marked with *
My Review for All HDDC2 Products
Required fields are marked with *
0
Inquiry Basket