Recombinant Human HDGF protein(71-150 aa), C-His-tagged

Cat.No. : HDGF-2784H
Product Overview : Recombinant Human HDGF protein(P51858)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-150 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE
Gene Name HDGF hepatoma-derived growth factor [ Homo sapiens ]
Official Symbol HDGF
Synonyms HDGF; hepatoma-derived growth factor; hepatoma derived growth factor (high mobility group protein 1 like); high mobility group protein 1 like; HMG1L2; HMG-1L2; high mobility group protein 1-like 2; FLJ96580; DKFZp686J1764;
Gene ID 3068
mRNA Refseq NM_001126050
Protein Refseq NP_001119522
MIM 600339
UniProt ID P51858

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDGF Products

Required fields are marked with *

My Review for All HDGF Products

Required fields are marked with *

0
cart-icon