Recombinant Human HDGF protein(71-150 aa), C-His-tagged

• Cat.No.: HDGF-2784H
• Product Overview: Recombinant Human HDGF protein(P51858)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 71-150 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE

Gene Information

• Gene Name: HDGF hepatoma-derived growth factor [ Homo sapiens ]
• Official Symbol: HDGF
• Synonyms: HDGF; hepatoma-derived growth factor; hepatoma derived growth factor (high mobility group protein 1 like); high mobility group protein 1 like; HMG1L2; HMG-1L2; high mobility group protein 1-like 2; FLJ96580; DKFZp686J1764
• Gene ID: 3068
• mRNA Refseq: NM_001126050
• Protein Refseq: NP_001119522
• MIM: 600339
• UniProt ID: P51858