Recombinant Human HECA Protein, GST-tagged
| Cat.No. : | HECA-4675H |
| Product Overview : | Human HECA partial ORF ( NP_057301, 434 a.a. - 543 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits terminal branching of neighboring cells during tracheal development. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HECA headcase homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | HECA |
| Synonyms | HECA; headcase homolog (Drosophila); headcase protein homolog; dJ225E12.1; HDC; HDCL; hHDC; HHDC; |
| Gene ID | 51696 |
| mRNA Refseq | NM_016217 |
| Protein Refseq | NP_057301 |
| MIM | 607977 |
| UniProt ID | Q9UBI9 |
| ◆ Recombinant Proteins | ||
| HECA-4166Z | Recombinant Zebrafish HECA | +Inquiry |
| HECA-4675H | Recombinant Human HECA Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HECA Products
Required fields are marked with *
My Review for All HECA Products
Required fields are marked with *
