Recombinant Human HECA Protein, GST-tagged

Cat.No. : HECA-4675H
Product Overview : Human HECA partial ORF ( NP_057301, 434 a.a. - 543 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits terminal branching of neighboring cells during tracheal development. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HECA headcase homolog (Drosophila) [ Homo sapiens ]
Official Symbol HECA
Synonyms HECA; headcase homolog (Drosophila); headcase protein homolog; dJ225E12.1; HDC; HDCL; hHDC; HHDC;
Gene ID 51696
mRNA Refseq NM_016217
Protein Refseq NP_057301
MIM 607977
UniProt ID Q9UBI9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HECA Products

Required fields are marked with *

My Review for All HECA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon