Recombinant Human HECTD1 Protein, GST-tagged

Cat.No. : HECTD1-4676H
Product Overview : Human HECTD1 partial ORF ( NP_056197, 3 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HECTD1 (HECT Domain E3 Ubiquitin Protein Ligase 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include binding and ubiquitin-protein transferase activity. An important paralog of this gene is TRIP12.
Molecular Mass : 37.62 kDa
AA Sequence : DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HECTD1 HECT domain containing E3 ubiquitin protein ligase 1 [ Homo sapiens ]
Official Symbol HECTD1
Synonyms HECTD1; HECT domain containing E3 ubiquitin protein ligase 1; HECT domain containing 1; E3 ubiquitin-protein ligase HECTD1; KIAA1131; EULIR; E3 ligase for inhibin receptor; HECT domain-containing protein 1; FLJ38315;
Gene ID 25831
mRNA Refseq NM_015382
Protein Refseq NP_056197
UniProt ID Q9ULT8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HECTD1 Products

Required fields are marked with *

My Review for All HECTD1 Products

Required fields are marked with *

0
cart-icon