Recombinant Human HECTD1 Protein, GST-tagged
Cat.No. : | HECTD1-4676H |
Product Overview : | Human HECTD1 partial ORF ( NP_056197, 3 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HECTD1 (HECT Domain E3 Ubiquitin Protein Ligase 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include binding and ubiquitin-protein transferase activity. An important paralog of this gene is TRIP12. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HECTD1 HECT domain containing E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
Official Symbol | HECTD1 |
Synonyms | HECTD1; HECT domain containing E3 ubiquitin protein ligase 1; HECT domain containing 1; E3 ubiquitin-protein ligase HECTD1; KIAA1131; EULIR; E3 ligase for inhibin receptor; HECT domain-containing protein 1; FLJ38315; |
Gene ID | 25831 |
mRNA Refseq | NM_015382 |
Protein Refseq | NP_056197 |
UniProt ID | Q9ULT8 |
◆ Recombinant Proteins | ||
HECTD1-631Z | Recombinant Zebrafish HECTD1 | +Inquiry |
HECTD1-2061R | Recombinant Rhesus monkey HECTD1 Protein, His-tagged | +Inquiry |
HECTD1-1882R | Recombinant Rhesus Macaque HECTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HECTD1-4676H | Recombinant Human HECTD1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HECTD1 Products
Required fields are marked with *
My Review for All HECTD1 Products
Required fields are marked with *
0
Inquiry Basket