Recombinant Human HECTD4 Protein, GST-tagged
Cat.No. : | HECTD4-511H |
Product Overview : | Human C12orf51 partial ORF ( XP_497354, 3105 a.a. - 3209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | DQHIEFFWGALEMFTQEELCKFIKFACNQERIPFTCPCKDGGPDTAHVPPYPMKIAPPDGTAGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAIHYREDPL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HECTD4 HECT domain containing E3 ubiquitin protein ligase 4 [ Homo sapiens (human) ] |
Official Symbol | HECTD4 |
Synonyms | probable E3 ubiquitin-protein ligase HECTD4; transmembrane protein C12orf51; HECT domain-containing protein 4; AF-1 specific protein phosphatase; probable E3 ubiquitin-protein ligase C12orf51; C12orf51; DKFZp586O1022; FLJ10510; FLJ30092; FLJ30208; FLJ34154; KIAA0614; MGC126531 |
Gene ID | 283450 |
mRNA Refseq | NM_001109662.3 |
Protein Refseq | NP_001103132.3 |
UniProt ID | Q9Y4D8 |
◆ Recombinant Proteins | ||
HECTD4-511H | Recombinant Human HECTD4 Protein, GST-tagged | +Inquiry |
HECTD4-3105H | Recombinant Human HECTD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HECTD4-1318H | Recombinant Human HECTD4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HECTD4 Products
Required fields are marked with *
My Review for All HECTD4 Products
Required fields are marked with *