Recombinant Human HECTD4  Protein, GST-tagged

Cat.No. : HECTD4-511H
Product Overview : Human C12orf51 partial ORF ( XP_497354, 3105 a.a. - 3209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.29 kDa
AA Sequence : DQHIEFFWGALEMFTQEELCKFIKFACNQERIPFTCPCKDGGPDTAHVPPYPMKIAPPDGTAGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAIHYREDPL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HECTD4 HECT domain containing E3 ubiquitin protein ligase 4 [ Homo sapiens (human) ]
Official Symbol HECTD4
Synonyms probable E3 ubiquitin-protein ligase HECTD4; transmembrane protein C12orf51; HECT domain-containing protein 4; AF-1 specific protein phosphatase; probable E3 ubiquitin-protein ligase C12orf51; C12orf51; DKFZp586O1022; FLJ10510; FLJ30092; FLJ30208; FLJ34154; KIAA0614; MGC126531
Gene ID 283450
mRNA Refseq NM_001109662.3
Protein Refseq NP_001103132.3
UniProt ID Q9Y4D8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HECTD4 Products

Required fields are marked with *

My Review for All HECTD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon