Recombinant Human HECW2 Protein, GST-tagged
Cat.No. : | HECW2-4680H |
Product Overview : | Human HECW2 partial ORF ( NP_065811, 637 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of E3 ubiquitin ligases which plays an important role in the proliferation, migration and differentiation of neural crest cells as a regulator of glial cell line-derived neurotrophic factor (GDNF)/Ret signaling. This gene also plays an important role in angiogenesis through stabilization of endothelial cell-to-cell junctions as a regulator of angiomotin-like 1 stability. The encoded protein contains an N-terminal calcium/lipid-binding (C2) domain involved in membrane targeting, two-four WW domains responsible for cellular localization and substrate recognition, and a C-terminal homologous with E6-associated protein C-terminus (HECT) catalytic domain. Naturally occurring mutations in this gene are associated with neurodevelopmental delay, hypotonia, and epilepsy. The decreased expression of this gene in the aganglionic colon is associated with Hirschsprung's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HECW2 HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
Official Symbol | HECW2 |
Synonyms | HECW2; HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2; E3 ubiquitin-protein ligase HECW2; KIAA1301; NEDL2; NEDD4-related E3 ubiquitin ligase NEDL2; NEDD4-like E3 ubiquitin-protein ligase 2; HECT, C2 and WW domain-containing protein 2; DKFZp686M17164; |
Gene ID | 57520 |
mRNA Refseq | NM_020760 |
Protein Refseq | NP_065811 |
UniProt ID | Q9P2P5 |
◆ Recombinant Proteins | ||
Hecw2-3380M | Recombinant Mouse Hecw2 Protein, Myc/DDK-tagged | +Inquiry |
HECW2-1100H | Recombinant Human HECW2 Protein, MYC/DDK-tagged | +Inquiry |
HECW2-4680H | Recombinant Human HECW2 Protein, GST-tagged | +Inquiry |
HECW2-4599H | Recombinant Human HECW2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HECW2-7564M | Recombinant Mouse HECW2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HECW2 Products
Required fields are marked with *
My Review for All HECW2 Products
Required fields are marked with *
0
Inquiry Basket