Recombinant Human HEPACAM, His-tagged
Cat.No. : | HEPACAM-101H |
Product Overview : | Recombinant Human Hepatocyte Cell Adhesion Molecule/HEPACAM produced by transfected human cellss is a secreted protein with sequence (Val34-Ser240) of Human HEPACAM fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 34-240 a.a. |
Description : | Hepatocyte Cell Adhesion Molecule (HEPACAM) is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. HEPACAM includes a signal sequence (amino acid 1-33), an extracellular region (amino acid 34-240) with one Ig-like C2-type domain and one Ig-like V-type domain, a transmembrane segment (amino acid 241-261), and a cytoplasmic domain (amino acid 262 - 416). The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility. HEPACAM acts as a homodimer and dimer formation occurs predominantly through cis interactions on the cell surface. HEPACAM is involved in cell motility and cell-matrix interactions. The expression of this gene is down-regulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDR IRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEA FTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRS LPVKITVYRRSSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | HEPACAM hepatic and glial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | HEPACAM |
Synonyms | HEPACAM; hepatic and glial cell adhesion molecule; hepatocyte cell adhesion molecule; FLJ25530; glial cell adhesion molecule; GLIALCAM; hepaCAM; protein hepaCAM; MLC2A; MLC2B; GlialCAM; |
Gene ID | 220296 |
mRNA Refseq | NM_152722 |
Protein Refseq | NP_689935 |
MIM | 611642 |
UniProt ID | Q14CZ8 |
Chromosome Location | 11q24.2 |
◆ Recombinant Proteins | ||
HEPACAM-366H | Recombinant Human HEPACAM Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HEPACAM-2852Z | Recombinant Zebrafish HEPACAM | +Inquiry |
HEPACAM-169HFL | Recombinant Full Length Human HEPACAM Protein, C-Flag-tagged | +Inquiry |
HEPACAM-1060H | Recombinant Human HEPACAM Protein, His (Fc)-Avi-tagged | +Inquiry |
HEPACAM-1101H | Recombinant Human HEPACAM Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEPACAM-319HCL | Recombinant Human HEPACAM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEPACAM Products
Required fields are marked with *
My Review for All HEPACAM Products
Required fields are marked with *
0
Inquiry Basket