Recombinant Human HEPACAM, His-tagged

Cat.No. : HEPACAM-101H
Product Overview : Recombinant Human Hepatocyte Cell Adhesion Molecule/HEPACAM produced by transfected human cellss is a secreted protein with sequence (Val34-Ser240) of Human HEPACAM fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 34-240 a.a.
Description : Hepatocyte Cell Adhesion Molecule (HEPACAM) is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. HEPACAM includes a signal sequence (amino acid 1-33), an extracellular region (amino acid 34-240) with one Ig-like C2-type domain and one Ig-like V-type domain, a transmembrane segment (amino acid 241-261), and a cytoplasmic domain (amino acid 262 - 416). The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility. HEPACAM acts as a homodimer and dimer formation occurs predominantly through cis interactions on the cell surface. HEPACAM is involved in cell motility and cell-matrix interactions. The expression of this gene is down-regulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDR IRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEA FTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRS LPVKITVYRRSSVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name HEPACAM hepatic and glial cell adhesion molecule [ Homo sapiens ]
Official Symbol HEPACAM
Synonyms HEPACAM; hepatic and glial cell adhesion molecule; hepatocyte cell adhesion molecule; FLJ25530; glial cell adhesion molecule; GLIALCAM; hepaCAM; protein hepaCAM; MLC2A; MLC2B; GlialCAM;
Gene ID 220296
mRNA Refseq NM_152722
Protein Refseq NP_689935
MIM 611642
UniProt ID Q14CZ8
Chromosome Location 11q24.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HEPACAM Products

Required fields are marked with *

My Review for All HEPACAM Products

Required fields are marked with *

0
cart-icon
0
compare icon