Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
34-240 a.a. |
Description : |
Hepatocyte Cell Adhesion Molecule (HEPACAM) is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. HEPACAM includes a signal sequence (amino acid 1-33), an extracellular region (amino acid 34-240) with one Ig-like C2-type domain and one Ig-like V-type domain, a transmembrane segment (amino acid 241-261), and a cytoplasmic domain (amino acid 262 - 416). The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility. HEPACAM acts as a homodimer and dimer formation occurs predominantly through cis interactions on the cell surface. HEPACAM is involved in cell motility and cell-matrix interactions. The expression of this gene is down-regulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene. |
Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : |
VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDR IRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEA FTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRS LPVKITVYRRSSVDHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |