Recombinant Human HEPACAM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HEPACAM2-1107H |
Product Overview : | HEPACAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034461) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein related to the immunoglobulin superfamily that plays a role in mitosis. Knockdown of this gene results in prometaphase arrest, abnormal nuclear morphology and apoptosis. Poly(ADP-ribosylation) of the encoded protein promotes its translocation to centrosomes, which may stimulate centrosome maturation. A chromosomal deletion including this gene may be associated with myeloid leukemia and myelodysplastic syndrome in human patients. |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDVSGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HEPACAM2 HEPACAM family member 2 [ Homo sapiens (human) ] |
Official Symbol | HEPACAM2 |
Synonyms | HEPACAM2; HEPACAM family member 2; FLJ38683; mitotic kinetics regulator; MIKI; |
Gene ID | 253012 |
mRNA Refseq | NM_001039372 |
Protein Refseq | NP_001034461 |
MIM | 614133 |
UniProt ID | A8MVW5 |
◆ Recombinant Proteins | ||
RFL5724BF | Recombinant Full Length Bovine Hepacam Family Member 2(Hepacam2) Protein, His-Tagged | +Inquiry |
HEPACAM2-1094H | Recombinant Human HEPACAM2 Protein, MYC/DDK-tagged | +Inquiry |
HEPACAM2-4124M | Recombinant Mouse HEPACAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9752HF | Recombinant Full Length Human Hepacam Family Member 2(Hepacam2) Protein, His-Tagged | +Inquiry |
HEPACAM2-2287H | Recombinant Human HEPACAM2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEPACAM2-1050RCL | Recombinant Rat HEPACAM2 cell lysate | +Inquiry |
HEPACAM2-1385RCL | Recombinant Rat HEPACAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEPACAM2 Products
Required fields are marked with *
My Review for All HEPACAM2 Products
Required fields are marked with *
0
Inquiry Basket