Recombinant Human HES1
Cat.No. : | HES1-27078TH |
Product Overview : | Recombinant fragment corresponding to amino acids 36-142 of Human Hes1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 107 amino acids |
Description : | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
Molecular Weight : | 37.400kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKL EKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFS ECMNEVTRFLSTCEGVNTEVRTRLLGH |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain. |
Gene Name | HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ] |
Official Symbol | HES1 |
Synonyms | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; |
Gene ID | 3280 |
mRNA Refseq | NM_005524 |
Protein Refseq | NP_005515 |
MIM | 139605 |
Uniprot ID | Q14469 |
Chromosome Location | 3q28-q29 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; |
Function | DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding; |
◆ Recombinant Proteins | ||
HES1-7586M | Recombinant Mouse HES1 Protein | +Inquiry |
HES1-141H | Recombinant Human HES1 Protein, His-tagged | +Inquiry |
HES1-2829R | Recombinant Rat HES1 Protein | +Inquiry |
Hes1-1111M | Recombinant Mouse Hes1 Protein, MYC/DDK-tagged | +Inquiry |
HES1-289H | Recombinant Human HES1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES1 Products
Required fields are marked with *
My Review for All HES1 Products
Required fields are marked with *