Recombinant Human HES1

Cat.No. : HES1-27078TH
Product Overview : Recombinant fragment corresponding to amino acids 36-142 of Human Hes1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 107 amino acids
Description : This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
Molecular Weight : 37.400kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKL EKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFS ECMNEVTRFLSTCEGVNTEVRTRLLGH
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain.
Gene Name HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
Official Symbol HES1
Synonyms HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1;
Gene ID 3280
mRNA Refseq NM_005524
Protein Refseq NP_005515
MIM 139605
Uniprot ID Q14469
Chromosome Location 3q28-q29
Pathway ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES1 Products

Required fields are marked with *

My Review for All HES1 Products

Required fields are marked with *

0
cart-icon
0
compare icon