Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human HES1

Cat.No. : HES1-27078TH
Product Overview : Recombinant fragment corresponding to amino acids 36-142 of Human Hes1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
Protein length : 107 amino acids
Molecular Weight : 37.400kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKL EKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFS ECMNEVTRFLSTCEGVNTEVRTRLLGH
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain.
Gene Name : HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
Official Symbol : HES1
Synonyms : HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1;
Gene ID : 3280
mRNA Refseq : NM_005524
Protein Refseq : NP_005515
MIM : 139605
Uniprot ID : Q14469
Chromosome Location : 3q28-q29
Pathway : ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function : DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends