Recombinant Human HES4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HES4-2588H |
| Product Overview : | HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'. |
| Molecular Mass : | 25.9 kDa |
| AA Sequence : | MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HES4 hes family bHLH transcription factor 4 [ Homo sapiens (human) ] |
| Official Symbol | HES4 |
| Synonyms | HES4; hairy and enhancer of split 4 (Drosophila); transcription factor HES-4; bHLHb42; hHES4; bHLH factor Hes4; class B basic helix-loop-helix protein 42; |
| Gene ID | 57801 |
| mRNA Refseq | NM_001142467 |
| Protein Refseq | NP_001135939 |
| MIM | 608060 |
| UniProt ID | Q9HCC6 |
| ◆ Recombinant Proteins | ||
| HES4-3518HF | Recombinant Full Length Human HES4 Protein, GST-tagged | +Inquiry |
| HES4-6042C | Recombinant Chicken HES4 | +Inquiry |
| HES4-1095H | Recombinant Human HES4 Protein, MYC/DDK-tagged | +Inquiry |
| HES4-4704H | Recombinant Human HES4 Protein, GST-tagged | +Inquiry |
| HES4-2588H | Recombinant Human HES4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HES4-781HCL | Recombinant Human HES4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES4 Products
Required fields are marked with *
My Review for All HES4 Products
Required fields are marked with *
