Recombinant Human HES4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HES4-2588H
Product Overview : HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'.
Molecular Mass : 25.9 kDa
AA Sequence : MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HES4 hes family bHLH transcription factor 4 [ Homo sapiens (human) ]
Official Symbol HES4
Synonyms HES4; hairy and enhancer of split 4 (Drosophila); transcription factor HES-4; bHLHb42; hHES4; bHLH factor Hes4; class B basic helix-loop-helix protein 42;
Gene ID 57801
mRNA Refseq NM_001142467
Protein Refseq NP_001135939
MIM 608060
UniProt ID Q9HCC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES4 Products

Required fields are marked with *

My Review for All HES4 Products

Required fields are marked with *

0
cart-icon