Recombinant Human HES5 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : HES5-436H
Product Overview : HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008]
Molecular Mass : 18 kDa
AA Sequence : MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HES5 hes family bHLH transcription factor 5 [ Homo sapiens (human) ]
Official Symbol HES5
Synonyms HES5; hes family bHLH transcription factor 5; bHLHb38; transcription factor HES-5; class B basic helix-loop-helix protein 38; hairy and enhancer of split 5
Gene ID 388585
mRNA Refseq NM_001010926
Protein Refseq NP_001010926
MIM 607348
UniProt ID Q5TA89

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES5 Products

Required fields are marked with *

My Review for All HES5 Products

Required fields are marked with *

0
cart-icon
0
compare icon