Recombinant Human HEXIM2 Protein, GST-tagged
Cat.No. : | HEXIM2-4714H |
Product Overview : | Human HEXIM2 full-length ORF ( NP_653209.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HEXIM2 hexamethylene bis-acetamide inducible 2 [ Homo sapiens ] |
Official Symbol | HEXIM2 |
Synonyms | HEXIM2; hexamethylene bis-acetamide inducible 2; protein HEXIM2; FLJ32384; MAQ1 paralog; hexamthylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; L3; |
Gene ID | 124790 |
mRNA Refseq | NM_144608 |
Protein Refseq | NP_653209 |
UniProt ID | Q96MH2 |
◆ Recombinant Proteins | ||
HEXIM2-1064H | Recombinant Human HEXIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HEXIM2-2599H | Recombinant Human HEXIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hexim2-3388M | Recombinant Mouse Hexim2 Protein, Myc/DDK-tagged | +Inquiry |
HEXIM2-1089H | Recombinant Human HEXIM2 Protein, MYC/DDK-tagged | +Inquiry |
HEXIM2-4142M | Recombinant Mouse HEXIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEXIM2 Products
Required fields are marked with *
My Review for All HEXIM2 Products
Required fields are marked with *