Recombinant Human HFE2 Protein, GST-tagged

Cat.No. : HFE2-4722H
Product Overview : Human HFE2 partial ORF ( NP_973733, 93 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq
Molecular Mass : 34.65 kDa
AA Sequence : GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HFE2 hemochromatosis type 2 (juvenile) [ Homo sapiens ]
Official Symbol HFE2
Synonyms HFE2; hemochromatosis type 2 (juvenile); hemojuvelin; haemojuvelin; HFE2A; HJV; JH; repulsive guidance molecule c; RGMC; RGM domain family member C; hemochromatosis type 2 protein; MGC23953;
Gene ID 148738
mRNA Refseq NM_145277
Protein Refseq NP_660320
MIM 608374
UniProt ID Q6ZVN8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HFE2 Products

Required fields are marked with *

My Review for All HFE2 Products

Required fields are marked with *

0
cart-icon