Recombinant Human HFE2 Protein, GST-tagged
Cat.No. : | HFE2-4722H |
Product Overview : | Human HFE2 partial ORF ( NP_973733, 93 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq |
Molecular Mass : | 34.65 kDa |
AA Sequence : | GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HFE2 hemochromatosis type 2 (juvenile) [ Homo sapiens ] |
Official Symbol | HFE2 |
Synonyms | HFE2; hemochromatosis type 2 (juvenile); hemojuvelin; haemojuvelin; HFE2A; HJV; JH; repulsive guidance molecule c; RGMC; RGM domain family member C; hemochromatosis type 2 protein; MGC23953; |
Gene ID | 148738 |
mRNA Refseq | NM_145277 |
Protein Refseq | NP_660320 |
MIM | 608374 |
UniProt ID | Q6ZVN8 |
◆ Recombinant Proteins | ||
HFE2-205C | Recombinant Cynomolgus HFE2, His-tagged | +Inquiry |
HFE2-4722H | Recombinant Human HFE2 Protein, GST-tagged | +Inquiry |
HFE2-469H | Recombinant Human HFE2 protein, His & Fc-tagged | +Inquiry |
HFE2-7602M | Recombinant Mouse HFE2 Protein | +Inquiry |
HFE2-7288H | Recombinant Human HFE2 protein(Met1-Ser399), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HFE2-001CCL | Recombinant Cynomolgus HFE2 cell lysate | +Inquiry |
HFE2-423HCL | Recombinant Human HFE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HFE2 Products
Required fields are marked with *
My Review for All HFE2 Products
Required fields are marked with *
0
Inquiry Basket