Recombinant Human HGF Protein, GST-tagged
Cat.No. : | HGF-4729H |
Product Overview : | Human HGF partial ORF ( AAH22308, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 35.86 kDa |
AA Sequence : | QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HGF hepatocyte growth factor (hepapoietin A; scatter factor) [ Homo sapiens ] |
Official Symbol | HGF |
Synonyms | HGF; hepatocyte growth factor (hepapoietin A; scatter factor); deafness, autosomal recessive 39 , DFNB39; hepatocyte growth factor; F TCF; fibroblast derived tumor cytotoxic factor; hepatopoietin A; HGFB; HPTA; lung fibroblast derived mitogen; scatter factor; SF; hepatopoeitin-A; hepatopoietin-A; lung fibroblast-derived mitogen; fibroblast-derived tumor cytotoxic factor; F-TCF; DFNB39; |
Gene ID | 3082 |
mRNA Refseq | NM_000601 |
Protein Refseq | NP_000592 |
MIM | 142409 |
UniProt ID | P14210 |
◆ Recombinant Proteins | ||
HGF-501H | Active Recombinant Human HGF | +Inquiry |
HGF-2847H | Recombinant Human HGF protein, For Organoid Culture | +Inquiry |
Hgf-8806RF | Recombinant Rat Hgf Protein, None-tagged, FITC conjugated | +Inquiry |
HGF-152CAF647 | Recombinant Cynomolgus HGF Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
HGF-6H | Active Recombinant Human HGF | +Inquiry |
◆ Native Proteins | ||
HGF-29231TH | Native Human HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *
0
Inquiry Basket