Recombinant Human HGF Protein, GST-tagged

Cat.No. : HGF-4729H
Product Overview : Human HGF partial ORF ( AAH22308, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 35.86 kDa
AA Sequence : QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HGF hepatocyte growth factor (hepapoietin A; scatter factor) [ Homo sapiens ]
Official Symbol HGF
Synonyms HGF; hepatocyte growth factor (hepapoietin A; scatter factor); deafness, autosomal recessive 39 , DFNB39; hepatocyte growth factor; F TCF; fibroblast derived tumor cytotoxic factor; hepatopoietin A; HGFB; HPTA; lung fibroblast derived mitogen; scatter factor; SF; hepatopoeitin-A; hepatopoietin-A; lung fibroblast-derived mitogen; fibroblast-derived tumor cytotoxic factor; F-TCF; DFNB39;
Gene ID 3082
mRNA Refseq NM_000601
Protein Refseq NP_000592
MIM 142409
UniProt ID P14210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HGF Products

Required fields are marked with *

My Review for All HGF Products

Required fields are marked with *

0
cart-icon
0
compare icon