Recombinant Human HGF protein, His-tagged
Cat.No. : | HGF-790H |
Product Overview : | Recombinant Human EWSR1 protein(Q01844)(Gly221-Leu440), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gly221-Leu440 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 26 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL |
Gene Name | EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ] |
Official Symbol | EWSR1 |
Synonyms | EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4; |
Gene ID | 2130 |
mRNA Refseq | NM_001163285 |
Protein Refseq | NP_001156757 |
MIM | 133450 |
UniProt ID | Q01844 |
◆ Recombinant Proteins | ||
HGF-6H | Active Recombinant Human HGF | +Inquiry |
HGF-607HFL | Active Recombinant Full Length Human HGF Protein, C-Flag-tagged | +Inquiry |
HGF-251H | Recombinant Human hepatocyte growth factor Protein, Tag Free | +Inquiry |
HGF-225H | Recombinant Human HGF | +Inquiry |
HGF-123H | Recombinant Human Hepatocyte Growth Factor (Hepapoietin A; Scatter factor) | +Inquiry |
◆ Native Proteins | ||
HGF-38P | Native Porcine HGF | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *