Recombinant Human HGF protein, His-tagged

Cat.No. : HGF-790H
Product Overview : Recombinant Human EWSR1 protein(Q01844)(Gly221-Leu440), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gly221-Leu440
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 26 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL
Gene Name EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ]
Official Symbol EWSR1
Synonyms EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4;
Gene ID 2130
mRNA Refseq NM_001163285
Protein Refseq NP_001156757
MIM 133450
UniProt ID Q01844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HGF Products

Required fields are marked with *

My Review for All HGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon