Recombinant Human HGF protein, His-tagged
| Cat.No. : | HGF-790H |
| Product Overview : | Recombinant Human EWSR1 protein(Q01844)(Gly221-Leu440), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gly221-Leu440 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 26 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL |
| Gene Name | EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ] |
| Official Symbol | EWSR1 |
| Synonyms | EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4; |
| Gene ID | 2130 |
| mRNA Refseq | NM_001163285 |
| Protein Refseq | NP_001156757 |
| MIM | 133450 |
| UniProt ID | Q01844 |
| ◆ Recombinant Proteins | ||
| Hgf-073M | Recombinant Mouse Hgf Protein, MYC/DDK-tagged | +Inquiry |
| Hgf-1237R | Recombinant Rat Hgf Protein, GST-tagged | +Inquiry |
| Hgf-8665MAF555 | Recombinant Mouse Hgf Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| HGF-793H | Recombinant Human HGF protein, His & GST-tagged | +Inquiry |
| HGF-195H | Active Recombinant Human HGF protein | +Inquiry |
| ◆ Native Proteins | ||
| HGF-232P | Native Porcine HGF | +Inquiry |
| HGF-29231TH | Native Human HGF | +Inquiry |
| HGF-38P | Native Porcine HGF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
| HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
| HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
| HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *
