Recombinant Human HGF protein, His-tagged
| Cat.No. : | HGF-790H |
| Product Overview : | Recombinant Human EWSR1 protein(Q01844)(Gly221-Leu440), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gly221-Leu440 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 26 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL |
| Gene Name | EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ] |
| Official Symbol | EWSR1 |
| Synonyms | EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4; |
| Gene ID | 2130 |
| mRNA Refseq | NM_001163285 |
| Protein Refseq | NP_001156757 |
| MIM | 133450 |
| UniProt ID | Q01844 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *



