Recombinant Human HHATL Protein, GST-tagged
| Cat.No. : | HHATL-4499H |
| Product Overview : | Human GUP1 partial ORF ( NP_065758.2, 157 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HHATL (Hedgehog Acyltransferase-Like) is a Protein Coding gene. Diseases associated with HHATL include Skin Squamous Cell Carcinoma. An important paralog of this gene is HHAT. |
| Molecular Mass : | 31.24 kDa |
| AA Sequence : | LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HHATL hedgehog acyltransferase-like [ Homo sapiens ] |
| Official Symbol | HHATL |
| Synonyms | GUP1; OACT3; C3orf3; MBOAT3; MSTP002 |
| Gene ID | 57467 |
| mRNA Refseq | NM_020707 |
| Protein Refseq | NP_065758 |
| MIM | 608116 |
| UniProt ID | Q9HCP6 |
| ◆ Recombinant Proteins | ||
| HHATL-4397C | Recombinant Chicken HHATL | +Inquiry |
| HHATL-7610M | Recombinant Mouse HHATL Protein | +Inquiry |
| HHATL-13765H | Recombinant Human HHATL, GST-tagged | +Inquiry |
| HHATL-4150M | Recombinant Mouse HHATL Protein, His (Fc)-Avi-tagged | +Inquiry |
| HHATL-4499H | Recombinant Human HHATL Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HHATL Products
Required fields are marked with *
My Review for All HHATL Products
Required fields are marked with *
