Recombinant Human HHATL Protein, GST-tagged

Cat.No. : HHATL-4499H
Product Overview : Human GUP1 partial ORF ( NP_065758.2, 157 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HHATL (Hedgehog Acyltransferase-Like) is a Protein Coding gene. Diseases associated with HHATL include Skin Squamous Cell Carcinoma. An important paralog of this gene is HHAT.
Molecular Mass : 31.24 kDa
AA Sequence : LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HHATL hedgehog acyltransferase-like [ Homo sapiens ]
Official Symbol HHATL
Synonyms GUP1; OACT3; C3orf3; MBOAT3; MSTP002
Gene ID 57467
mRNA Refseq NM_020707
Protein Refseq NP_065758
MIM 608116
UniProt ID Q9HCP6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HHATL Products

Required fields are marked with *

My Review for All HHATL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon