Recombinant Human HHIP Protein, GST-tagged

Cat.No. : HHIP-4737H
Product Overview : Human HHIP partial ORF ( NP_071920, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HHIP hedgehog interacting protein [ Homo sapiens ]
Official Symbol HHIP
Synonyms HHIP; hedgehog interacting protein; hedgehog-interacting protein; FLJ20992; HIP; FLJ90230;
Gene ID 64399
mRNA Refseq NM_022475
Protein Refseq NP_071920
MIM 606178
UniProt ID Q96QV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HHIP Products

Required fields are marked with *

My Review for All HHIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon