Recombinant Human HHIP Protein, GST-tagged
Cat.No. : | HHIP-4737H |
Product Overview : | Human HHIP partial ORF ( NP_071920, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HHIP hedgehog interacting protein [ Homo sapiens ] |
Official Symbol | HHIP |
Synonyms | HHIP; hedgehog interacting protein; hedgehog-interacting protein; FLJ20992; HIP; FLJ90230; |
Gene ID | 64399 |
mRNA Refseq | NM_022475 |
Protein Refseq | NP_071920 |
MIM | 606178 |
UniProt ID | Q96QV1 |
◆ Recombinant Proteins | ||
Hhip-271M | Active Recombinant Mouse Hhip | +Inquiry |
HHIP-4962Z | Recombinant Zebrafish HHIP | +Inquiry |
HHIP-4737H | Recombinant Human HHIP Protein, GST-tagged | +Inquiry |
HHIP-7612M | Recombinant Mouse HHIP Protein | +Inquiry |
HHIP-1897R | Recombinant Rhesus Macaque HHIP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHIP-784HCL | Recombinant Human HHIP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HHIP Products
Required fields are marked with *
My Review for All HHIP Products
Required fields are marked with *
0
Inquiry Basket