Recombinant Human HIF1A protein, GST-tagged
Cat.No. : | HIF1A-198H |
Product Overview : | Recombinant Human HIF1A(574-799aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | July 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 574-799aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | LRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIH KETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKME HDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSY D |
Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ] |
Official Symbol | HIF1A |
Synonyms | HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA; |
Gene ID | 3091 |
mRNA Refseq | NM_001243084 |
Protein Refseq | NP_001230013 |
MIM | 603348 |
UniProt ID | Q16665 |
Chromosome Location | 14q23.2 |
Pathway | Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; |
Function | Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
HIF1A-5020H | Recombinant Human Hypoxia Inducible Factor 1, Alpha Subunit, His-tagged | +Inquiry |
HIF1A-7714C | Recombinant Chicken HIF1A protein, His-tagged | +Inquiry |
HIF1A-2941H | Recombinant Human HIF1A Protein (Arg575-Asn826), His tagged | +Inquiry |
HIF1A-280H | Recombinant Human HIF1A protein, His/MBP-tagged | +Inquiry |
HIF1A-2496R | Recombinant Rat HIF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1A-787HCL | Recombinant Human HIF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIF1A Products
Required fields are marked with *
My Review for All HIF1A Products
Required fields are marked with *