Recombinant Human HIF1AN protein, His&Myc-tagged
| Cat.No. : | HIF1AN-6733H |
| Product Overview : | Recombinant Human HIF1AN protein(Q9NWT6)(2-349aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-349a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN |
| Gene Name | HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ] |
| Official Symbol | HIF1AN |
| Synonyms | HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase; |
| Gene ID | 55662 |
| mRNA Refseq | NM_017902 |
| Protein Refseq | NP_060372 |
| MIM | 606615 |
| UniProt ID | Q9NWT6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
